PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 68508
Common NameSELMODRAFT_48444, SELMODRAFT_68508
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ZF-HD
Protein Properties Length: 184aa    MW: 20639.4 Da    PI: 9.5958
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
68508genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.85.2e-33155459
  ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                 vrY+eClkNhAa +Ggha+DGCgEfmps geegt+++lkC+AC+CHRnFHRreve 
        68508  1 VRYRECLKNHAAGIGGHALDGCGEFMPS-GEEGTIESLKCSACDCHRNFHRREVEG 55
                 69*************************9.999*********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.4E-30153IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-23265IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-32253IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.068352IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.65E-19115183IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-30119183IPR009057Homeodomain-like
TIGRFAMsTIGR015653.5E-27122179IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
VRYRECLKNH AAGIGGHALD GCGEFMPSGE EGTIESLKCS ACDCHRNFHR REVEGAKDVM  60
SKKKPSSVLP LQQHGSPLGS MARSPGALVA LSNSDQSDDH DLGAQHQTTY SLAHHLIPSA  120
IKKRFRTKFT NEQKEKMFHF AHRLGWKIQK HDEGEVQQFC ADVGVKRHVL KVWMHNNKNT  180
FGKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-271231801875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002983043.11e-137hypothetical protein SELMODRAFT_48444, partial
RefseqXP_002965557.11e-137hypothetical protein SELMODRAFT_68508, partial
SwissprotQ6YXH51e-63ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLD8R3P41e-137D8R3P4_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ158521e-137(Selaginella moellendorffii)
STRINGEFJ329771e-137(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-62homeobox protein 22
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]